PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.07G126200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family WOX
Protein Properties Length: 183aa    MW: 21317.8 Da    PI: 7.3485
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.07G126200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.38.4e-212990157
                         TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         ++ R+++t+eq+++L +lF++  r+ps++++++++++l    +++ ++V++WFqN++a+e++
  Manes.07G126200.1.p 29 KCGRWNPTSEQVKVLTDLFRSgLRTPSTDQIQKISSQLsfygKIESKNVFYWFQNHKARERQ 90
                         568*****************99**************************************97 PP

2Wus_type_Homeobox113.98.2e-372992265
    Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                         ++ RW+Pt+eQ+k+L++l++sGlrtP++++iq+i+++L+ yGkie+kNVfyWFQN+kaRerqk+
  Manes.07G126200.1.p 29 KCGRWNPTSEQVKVLTDLFRSGLRTPSTDQIQKISSQLSFYGKIESKNVFYWFQNHKARERQKR 92
                         578***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.2242691IPR001356Homeobox domain
SMARTSM003893.0E-42895IPR001356Homeobox domain
PfamPF000465.3E-183090IPR001356Homeobox domain
SuperFamilySSF466898.13E-123193IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-83290IPR009057Homeodomain-like
CDDcd000864.67E-43292No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MEERMSGFCI TKARNISSNG SGDSNSGNKC GRWNPTSEQV KVLTDLFRSG LRTPSTDQIQ  60
KISSQLSFYG KIESKNVFYW FQNHKARERQ KRRRVFVDDE DMMIRREDNL STSARYFSEI  120
NQVNEQERVI ETLELFPLNS FREGESDKLR FQSNECKEPT PFSYTFGTEM DHPPLDLRLS  180
FL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19094KRRRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002526863.11e-103PREDICTED: WUSCHEL-related homeobox 7
SwissprotQ8H1D24e-60WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBLB9SLJ41e-103B9SLJ4_RICCO; Protein WUSCHEL, putative
STRINGPOPTR_0010s19950.15e-89(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60143452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.12e-58WUSCHEL related homeobox 5